PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo1G0027200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 307aa    MW: 33149.5 Da    PI: 8.4677
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo1G0027200genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.51.2e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+d ++++G+g +W + +++ g++R++k+c++rw++yl
   Spipo1G0027200 14 KGPWSPEEDAKLKDHIEKHGTGgNWIALPQKAGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding43.19.6e-1469111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +T+eEd ++ +++ + G++ W+ Ia+ ++ gRt++++k++w++
   Spipo1G0027200  69 GDFTEEEDAIICNLFSRIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.407962IPR017930Myb domain
SuperFamilySSF466892.56E-2811109IPR009057Homeodomain-like
SMARTSM007171.6E-121364IPR001005SANT/Myb domain
PfamPF002492.2E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-241569IPR009057Homeodomain-like
CDDcd001676.41E-101662No hitNo description
PROSITE profilePS5129423.40363117IPR017930Myb domain
SMARTSM007171.7E-1267115IPR001005SANT/Myb domain
PfamPF002492.1E-1269111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-2470117IPR009057Homeodomain-like
CDDcd001672.65E-971113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDAKLKDHIE KHGTGGNWIA LPQKAGLKRC GKSCRLRWLN  60
YLRPNIKHGD FTEEEDAIIC NLFSRIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKIMGI  120
PTPQRKMQPE KHQRQLLPSS SDAMISLATS SIGSRFSSQR TLLPGPDAFG PVTAAGALLH  180
VLNDDHYQVK DSSSSLLVFG GVQSCSSSDG SSDKINYGRA AEYELGLETL LYGGVLEDHP  240
KLFPGGGSRV ERESGVWGEA PIDYTLEEIK QLITTGSACS NLFMGDPTGA IGGGGNARGS  300
GLVSYN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C9e-261411727128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006381399.11e-98hypothetical protein POPTR_0006s12530g
TrEMBLU5GA631e-98U5GA63_POPTR; Uncharacterized protein
STRINGPOPTR_0006s12530.14e-98(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65790.11e-76myb domain protein 68